PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G362200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 365aa    MW: 39322.4 Da    PI: 7.2029
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G362200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.7e-191461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEde+lv ++k++G g+W+t ++  g+ R++k+c++rw +yl
  Sevir.2G362200.1.p 14 KGPWTPEEDEKLVAYIKKHGQGNWRTLPKNAGLARCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding54.52.8e-1767111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Sevir.2G362200.1.p  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                         89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.537965IPR017930Myb domain
SuperFamilySSF466898.44E-3211108IPR009057Homeodomain-like
SMARTSM007171.9E-151363IPR001005SANT/Myb domain
PfamPF002495.1E-171461IPR001005SANT/Myb domain
CDDcd001671.55E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129420.4666116IPR017930Myb domain
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001672.33E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGRAPCCEKS GLKKGPWTPE EDEKLVAYIK KHGQGNWRTL PKNAGLARCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRL DLLDLSALLK PAAYYPTQAD LDALRAFEPL ASYPDLLRLA STLLSSGSAA  180
APAAIGDQQQ LLPWLLQAQM AQAAAMALPQ QADHQFMSQQ QQQAGAACQM PDLVHANPMV  240
QQQQLAAAAQ QQQQQHQDMA AAACNSMQAP PSGYVDGLDV PALMQMVQPD ASNLQQWSST  300
VTSSNNNNVG SGVSTPSSSP VAAGLNHSAA STATTYGGGA SASSDAAALF SMQLSELLDV  360
SDYM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2485790.0AK248579.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf97l09, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958010.10.0PREDICTED: uncharacterized protein LOC101782226
TrEMBLK3ZUJ20.0K3ZUJ2_SETIT; Uncharacterized protein
STRINGSi030273m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.19e-85MYB-like 102